| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Glutathione Peroxidase 2/GPX2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Glutathione Peroxidase 2/GPX2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Glutathione Peroxidase 2/GPX2. This antibody reacts with human. The Glutathione Peroxidase 2/GPX2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Glutathione Peroxidase 2/GPX2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVA |
|---|
| Other Names | EC 1.11.1, EC 1.11.1.9, Gastrointestinal glutathione peroxidase, gastrointestinal glutathione peroxidase 2, GI-GPx, glutathione peroxidase 2, glutathione peroxidase 2 (gastrointestinal), Glutathione peroxidase-gastrointestinal, Glutathione peroxidase-related protein 2, GPRP, GPRP-2, GPx-2, GPx-GI, GSHPx-2, GSHPx-GI |
|---|
| Gene, Accession # | GPX2, Gene ID: 2877 |
|---|
| Catalog # | NBP2-47447 |
|---|
| Price | |
|---|
| Order / More Info | Glutathione Peroxidase 2/GPX2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|