| Edit |   |
|---|
| Antigenic Specificity | Glutaminyl-peptide Cyclotransferase/QPCT |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Glutaminyl-peptide Cyclotransferase/QPCT Antibody from Novus Biologicals is a rabbit polyclonal antibody to Glutaminyl-peptide Cyclotransferase/QPCT. This antibody reacts with human. The Glutaminyl-peptide Cyclotransferase/QPCT Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human QPCTThe immunogen for this antibody is QPCT. Peptide sequence SRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSA. |
|---|
| Other Names | EC 2.3.2.5, GCT, Glutaminyl cyclase, glutaminyl-peptide cyclotransferase, Glutaminyl-tRNA cyclotransferase, Glutamyl cyclase, QCEC, sQC |
|---|
| Gene, Accession # | QPCT, Gene ID: 25797, Accession: NP_036545, SwissProt: NP_036545 |
|---|
| Catalog # | NBP1-79295 |
|---|
| Price | |
|---|
| Order / More Info | Glutaminyl-peptide Cyclotransferase/QPCT Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|