| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GPR162 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GPR162 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GPR162. This antibody reacts with human. The GPR162 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human GPR162 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIFSTPREPGSFLHKWSSSDDIRVLPAQSRALGGPPEYL |
|---|
| Other Names | A-2, FLJ78837, G protein-coupled receptor 162, Gene-rich cluster gene A protein, GRCAgene rich cluster, A, probable G-protein coupled receptor 162 |
|---|
| Gene, Accession # | GPR162, Gene ID: 27239, Accession: Q16538, SwissProt: Q16538 |
|---|
| Catalog # | NBP2-33740 |
|---|
| Price | |
|---|
| Order / More Info | GPR162 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|