| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SEC13 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SEC13 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SEC13. This antibody reacts with human. The SEC13 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SEC13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSD |
|---|
| Other Names | D3S1231ESEC13L1npp-20, protein SEC13 homolog, SEC13 (S. cerevisiae)-like 1, SEC13 homolog (S. cerevisiae), SEC13L1, SEC13-like 1 isoform, SEC13-like protein 1, SEC13-related protein, SEC13RSEC13-like 1 (S. cerevisiae) |
|---|
| Gene, Accession # | SEC13, Gene ID: 6396 |
|---|
| Catalog # | NBP2-58235 |
|---|
| Price | |
|---|
| Order / More Info | SEC13 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|