| 产品详情 |
| Edit |   |
| Antigenic Specificity | SEC16A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. Use in Western blot reported in scientific literature (PMID 28710282). |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SEC16A Antibody from Novus Biologicals is a rabbit polyclonal antibody to SEC16A. This antibody reacts with human. The SEC16A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SEC16A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKAPGDLPAAGGPPSGAMPFYNPAQ |
| Other Names | FLJ26737, KIAA0310RP11-413M3.10, p250protein SEC16 homolog A, SEC16, SEC16 homolog A, SEC16 homolog A (S. cerevisiae), SEC16Lprotein transport protein Sec16A |
| Gene, Accession # | SEC16A, Gene ID: 9919 |
| Catalog # | NBP1-83016 |
| Price | |
| Order / More Info | SEC16A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 28710282 |
| 产品资料 |
|
|