| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Ephrin-B2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 21539827). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Ephrin-B2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ephrin-B2. This antibody reacts with human, mouse. The Ephrin-B2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Ephrin-B2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMP |
|---|
| Other Names | ephrin B2, EPLG5, Htk-L, HTKL, LERK5 |
|---|
| Gene, Accession # | EFNB2, Gene ID: 1948 |
|---|
| Catalog # | NBP1-84830 |
|---|
| Price | |
|---|
| Order / More Info | Ephrin-B2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 21539827, 23354168, 24298057 |
|---|
| 产品资料 |
|
|