| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Ephrin-A5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Use in Western blot reported in scientific literature (PMID 28169277). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Ephrin-A5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ephrin-A5. This antibody reacts with human, mouse. The Ephrin-A5 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human, mouse Ephrin-A5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQ |
|---|
| Other Names | AF1, AL-1, EPH-related receptor tyrosine kinase ligand 7, ephrin-A5, EPLG7, GLC1M, LERK-7, LERK7EFL5, RAGS |
|---|
| Gene, Accession # | EFNA5, Gene ID: 1946 |
|---|
| Catalog # | NBP2-58251 |
|---|
| Price | |
|---|
| Order / More Info | Ephrin-A5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 28169277 |
|---|
| 产品资料 |
|
|