| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ECHDC2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ECHDC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ECHDC2. This antibody reacts with human. The ECHDC2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ECHDC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LIFTGRRLSGTEAHVLGLVNHAVAQNEEGDAAYQRARALAQEILPQAPIAVRLGKVAIDRGTEVDIASGM |
|---|
| Other Names | DKFZp686F0985, DKFZp686K13244, enoyl CoA hydratase domain containing 2, enoyl Coenzyme A hydratase domain containing 2, FLJ10948, FLJ45240, FLJ52213, FLJ52450, FLJ78805, FLJ99576, MGC57155, mitochondrial |
|---|
| Gene, Accession # | ECHDC2, Gene ID: 55268 |
|---|
| Catalog # | NBP1-83802 |
|---|
| Price | |
|---|
| Order / More Info | ECHDC2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23276153 |
|---|
| 产品资料 |
|
|