| Edit |   |
| Antigenic Specificity | ECHDC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ECHDC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ECHDC1. This antibody reacts with human. The ECHDC1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ECHDC1(enoyl Coenzyme A hydratase domain containing 1) The peptide sequence was selected from the middle region of ECHDC1. Peptide sequence GVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDG. |
| Other Names | dJ351K20.2, DKFZp762M1110, enoyl CoA hydratase domain containing 1, enoyl Coenzyme A hydratase domain containing 1, enoyl-CoA hydratase domain-containing protein 1, FLJ40827 |
| Gene, Accession # | ECHDC1, Gene ID: 55862, Accession: Q9NTX5, SwissProt: Q9NTX5 |
| Catalog # | NBP1-53053 |
| Price | |
| Order / More Info | ECHDC1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |