| Edit |   |
| Antigenic Specificity | KRT222 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KRT222 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KRT222. This antibody reacts with human. The KRT222 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to KRT222P(keratin 222 pseudogene) The peptide sequence was selected from the N terminal of KRT222P. Peptide sequence ELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAA. |
| Other Names | keratin 222, truncated type I keratin KA21 |
| Gene, Accession # | KRT222, Gene ID: 125113 |
| Catalog # | NBP1-70595 |
| Price | |
| Order / More Info | KRT222 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |