| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Ceramide Kinase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Ceramide Kinase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ceramide Kinase. This antibody reacts with human. The Ceramide Kinase Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human Ceramide Kinase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VLHGLIGRTQRSAGVDQNHPRAVLVPSSLRIGIIPAGSTDCVCYSTVGTSDAETSALHIVVGDSLAMDVSSVHHNSTLL |
|---|
| Other Names | ceramide kinase, dA59H18.2, DKFZp434E0211, EC 2.7.1.138, FLJ21430, FLJ23239, hCERKLipid kinase 4, KIAA1646dA59H18.3, lipid kinase LK4, LK4Acylsphingosine kinase, MGC131878 |
|---|
| Gene, Accession # | CERK, Gene ID: 64781 |
|---|
| Catalog # | NBP2-55991 |
|---|
| Price | |
|---|
| Order / More Info | Ceramide Kinase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|