| Edit |   |
|---|
| Antigenic Specificity | CEP170B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CEP170B Antibody from Novus Biologicals is a rabbit polyclonal antibody to CEP170B. This antibody reacts with human. The CEP170B Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human KIAA0284 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QPLRAQKEMSPSPPAAQDPGGTALVSAREQSSERQHHPLGPTDMGRGEPVRRSAIRRGHRPRGSLDWPSEERGPVLAHLPSSDVMASNHET |
|---|
| Other Names | KIAA0284 |
|---|
| Gene, Accession # | CEP170B, Gene ID: 283638, Accession: Q9Y4F5, SwissProt: Q9Y4F5 |
|---|
| Catalog # | NBP2-31739 |
|---|
| Price | |
|---|
| Order / More Info | CEP170B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|