| Edit |   |
| Antigenic Specificity | CEP89 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CEP89 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CEP89. This antibody reacts with human. The CEP89 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CEP89 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QVLKDKQEVLDQALQQNREMEGELEVIWESTFRENRRIRELLQDTLTRTGVQDNPRALVAPSLNGVSQADLLDGCDVCSYD |
| Other Names | CCDC123, centrosomal protein 89kDa, centrosomal protein of 89 kDa, coiled-coil domain containing 123, coiled-coil domain-containing protein 123, mitochondrial, FLJ14640 |
| Gene, Accession # | CEP89, Gene ID: 84902, Accession: Q96ST8, SwissProt: Q96ST8 |
| Catalog # | NBP2-38446 |
| Price | |
| Order / More Info | CEP89 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |