| 产品详情 |
| Edit |   |
| Antigenic Specificity | GBE1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Western Blot verified by a customer review. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GBE1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GBE1. This antibody reacts with human, rat. The GBE1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat GBE1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVP |
| Other Names | 1,4-alpha-glucan-branching enzyme, amylo-(1,4 to 1,6) transglucosidase, amylo-(1,4 to 1,6) transglycosylase, Brancher enzyme, EC 2.4.1.18, GBE, glucan (1,4-alpha), branching enzyme 1, glycogen branching enzyme, Glycogen-branching enzyme |
| Gene, Accession # | GBE1, Gene ID: 2632 |
| Catalog # | NBP1-85875 |
| Price | |
| Order / More Info | GBE1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|