| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TTC3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TTC3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TTC3. This antibody reacts with human. The TTC3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TTC3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KPGSEDANYKRVSCNSPKPVLEDVKPTYWAQSHLVTGYCTYLPFQRFDITQTPPAYINVLPGLPQYTSIYTPLASLSPEYQLPRSVPVVPSFVAND |
|---|
| Other Names | DCRR1tetratricopeptide repeat protein 3 (TPR repeat protein D)10RNF105DKFZp686M0150, E3 ubiquitin-protein ligase TTC3, EC 6.3.2.-, Protein DCRR1, RING finger protein 105, tetratricopeptide repeat domain 3, Tetratricopeptide repeat protein 3, TPR repeat protein 3, TPR repeat protein D, TPRDI, TPRDII, TPRDTPRDIII |
|---|
| Gene, Accession # | TTC3, Gene ID: 7267 |
|---|
| Catalog # | NBP2-55316 |
|---|
| Price | |
|---|
| Order / More Info | TTC3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|