| Edit |   |
| Antigenic Specificity | TTC27 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TTC27 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TTC27. This antibody reacts with human. The TTC27 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human TTC27The immunogen for this antibody is TTC27. Peptide sequence KDQLDIAKDISQLQIDLTGALGKRTRFQENYVAQLILDVRREGDVLSNCE. |
| Other Names | FLJ20272, tetratricopeptide repeat domain 27, tetratricopeptide repeat protein 27, TPR repeat protein 27 |
| Gene, Accession # | TTC27, Gene ID: 55622, Accession: NP_060205, SwissProt: NP_060205 |
| Catalog # | NBP1-79659-20ul |
| Price | |
| Order / More Info | TTC27 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |