| Edit |   |
| Antigenic Specificity | TTC16 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TTC16 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TTC16. This antibody reacts with human. The TTC16 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TTC16(tetratricopeptide repeat domain 16) The peptide sequence was selected from the C terminal of TTC16. Peptide sequence RSRGLLRSSTKTEAFYDSNWSLSKTEYAQGQGQRSSKAEGAQGKSQGMSS. |
| Other Names | FLJ32780, tetratricopeptide repeat domain 16, tetratricopeptide repeat protein 16, TPR repeat protein 16 |
| Gene, Accession # | TTC16, Gene ID: 158248, Accession: Q8NEE8, SwissProt: Q8NEE8 |
| Catalog # | NBP1-55177-20ul |
| Price | |
| Order / More Info | TTC16 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |