| Edit |   |
| Antigenic Specificity | HIV-1 Rev binding protein (HRB) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HIV-1 Rev binding protein (HRB) Antibody from Novus Biologicals is a rabbit polyclonal antibody to HIV-1 Rev binding protein (HRB). This antibody reacts with human. The HIV-1 Rev binding protein (HRB) Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to HRB(HIV-1 Rev binding protein) The peptide sequence was selected from the middle region of HRB. Peptide sequence SQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFN. |
| Other Names | ArfGAP with FG repeats 1, DKFZp686I15205, HIV-1 Rev-binding protein, HRBRev interacting protein, Rab, Rev/Rex activation domain-binding protein, RABMGC116938, RIPMGC116940 |
| Gene, Accession # | AGFG1, Gene ID: 3267, Accession: P52594, SwissProt: P52594 |
| Catalog # | NBP1-57277 |
| Price | |
| Order / More Info | HIV-1 Rev binding protein (HRB) Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |