| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Napsin A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Napsin A Antibody from Novus Biologicals is a rabbit polyclonal antibody to Napsin A. This antibody reacts with human. The Napsin A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Napsin A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SDPAHYIPPLTFVPVTVPAYWQIHMERVKVG |
|---|
| Other Names | Asp 4, ASP4, Aspartyl protease 4, EC 3.4.23, EC 3.4.23.-, EC 3.4.23.15, EC 3.4.23.3, EC 3.4.23.5, KAP, Kdap, NAP1napsin-A, NAPApronapsin A, NAPSA, napsin A aspartic peptidase, napsin-1, SNAPA, TA01/TA02 |
|---|
| Gene, Accession # | NAPSA, Gene ID: 9476, Accession: O96009, SwissProt: O96009 |
|---|
| Catalog # | NBP2-34213 |
|---|
| Price | |
|---|
| Order / More Info | Napsin A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|