| 产品详情 |
| Edit |   |
| Antigenic Specificity | NAPRT1 |
| Clone | CL0366 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG1 |
| Format | Protein A purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NAPRT1 Antibody (CL0366) from Novus Biologicals is a mouse monoclonal antibody to NAPRT1. This antibody reacts with human. The NAPRT1 Antibody (CL0366) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human NAPRT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSV |
| Other Names | EC 2.4.2.11, FHA-HIT-interacting protein, FHIP, NAPRTase, nicotinate phosphoribosyltransferase, nicotinate phosphoribosyltransferase domain containing 1, Nicotinate phosphoribosyltransferase domain-containing protein 1, nicotinic acid phosphoribosyltransferase, PP3856 |
| Gene, Accession # | NAPRT1, Gene ID: 93100 |
| Catalog # | NBP2-52924 |
| Price | |
| Order / More Info | NAPRT1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|