| Edit |   |
| Antigenic Specificity | ENKD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ENKD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ENKD1. This antibody reacts with human. The ENKD1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ENKD1 The peptide sequence was selected from the C terminal of ENKD1. Peptide sequence DLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKLLQSQSQLLRELV. |
| Other Names | C16orf48, chromosome 16 open reading frame 48, DAKV6410, DKFZp434A1319, hypothetical protein LOC84080 |
| Gene, Accession # | ENKD1, Gene ID: 84080, Accession: Q9H0I2, SwissProt: Q9H0I2 |
| Catalog # | NBP1-56350 |
| Price | |
| Order / More Info | ENKD1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |