| Edit |   |
|---|
| Antigenic Specificity | EN1/Engrailed 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EN1/Engrailed 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EN1/Engrailed 1. This antibody reacts with human. The EN1/Engrailed 1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to EN1(engrailed homeobox 1) The peptide sequence was selected from the C terminal of EN1. Peptide sequence LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK. |
|---|
| Other Names | engrailed homeobox 1, engrailed homolog 1, Homeobox protein en-1, homeobox protein engrailed-1, hu-En-1 |
|---|
| Gene, Accession # | EN1, Gene ID: 2019, Accession: Q05925, SwissProt: Q05925 |
|---|
| Catalog # | NBP1-56532 |
|---|
| Price | |
|---|
| Order / More Info | EN1/Engrailed 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|