| Edit |   |
|---|
| Antigenic Specificity | NARF |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NARF Antibody from Novus Biologicals is a rabbit polyclonal antibody to NARF. This antibody reacts with human. The NARF Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to NARF(nuclear prelamin A recognition factor) The peptide sequence was selected from the middle region of NARF. Peptide sequence FRNIQNMILKLKKGKFPFHFVEVLACAGGCLNGRGQAQTPDGHADKALLR. |
|---|
| Other Names | FLJ10067, IOP2DKFZp434G0420, Iron-only hydrogenase-like protein 2, nuclear prelamin A recognition factor, prenyl-dependent prelamin A binding protein |
|---|
| Gene, Accession # | NARF, Gene ID: 26502, Accession: Q9UHQ1-2, SwissProt: Q9UHQ1-2 |
|---|
| Catalog # | NBP1-54360-20ul |
|---|
| Price | |
|---|
| Order / More Info | NARF Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|