| Edit |   |
|---|
| Antigenic Specificity | TANK |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TANK Antibody from Novus Biologicals is a rabbit polyclonal antibody to TANK. This antibody reacts with human. The TANK Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TANK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IRTTLDRAACLPPGDHNALYVNSFPLLDPSDAPFPSLDSPGKAIRGPQQPIWKPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSIT |
|---|
| Other Names | ITRAF, I-TRAFTRAF2, TRAF family member-associated NF-kappa-B activator, TRAF family member-associated NFKB activator, TRAF-interacting protein |
|---|
| Gene, Accession # | TANK, Gene ID: 10010, Accession: Q92844, SwissProt: Q92844 |
|---|
| Catalog # | NBP2-38357 |
|---|
| Price | |
|---|
| Order / More Info | TANK Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|