| Edit |   |
|---|
| Antigenic Specificity | TANGO2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TANGO2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TANGO2. This antibody reacts with human. The TANGO2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C22ORF25 The peptide sequence was selected from the N terminal of C22ORF25. Peptide sequence MCIIFFKFDPRPVSKNAYRLILAANRDEFYSRPSKLADFWGNNNEILSGL. |
|---|
| Other Names | chromosome 22 open reading frame 25 |
|---|
| Gene, Accession # | TANGO2, Gene ID: 128989 |
|---|
| Catalog # | NBP1-70463-20ul |
|---|
| Price | |
|---|
| Order / More Info | TANGO2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|