| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GATE-16/GABARAPL2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GATE-16/GABARAPL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GATE-16/GABARAPL2. This antibody reacts with human. The GATE-16/GABARAPL2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GATE-16/GABARAPL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKE |
|---|
| Other Names | ATG8, ATG8C, FLC3A, gamma-aminobutyric acid receptor-associated protein-like 2, Ganglioside expression factor 2, GATE16, GATE-16, GEF2, GEF-2, GEF2GEF-2, General Protein Transport Factor P16, Golgi-Associated ATPase Enhancer Of 16 KDa, MAP1 light chain 3 related protein, MAP1 light chain 3-related protein |
|---|
| Gene, Accession # | GABARAPL2, Gene ID: 11345 |
|---|
| Catalog # | NBP1-88883 |
|---|
| Price | |
|---|
| Order / More Info | GATE-16/GABARAPL2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23435261 |
|---|
| 产品资料 |
|
|