| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GATD3A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GATD3A Antibody from Novus Biologicals is a rabbit polyclonal antibody to GATD3A. This antibody reacts with human. The GATD3A Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human C21orf33 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GGRTPSQRAALHLSVPRPAARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRN |
|---|
| Other Names | chromosome 21 open reading frame 33, D21S2048E, ES1, GT335, HES1, HES1KNP-Ia, human HES1 protein, homolog to E.coli and zebrafish ES1 protein, 10Protein GT335, Keio novel protein I, KNPH, KNPI, KNP-I, KNPImitochondrial, Protein KNP-I |
|---|
| Gene, Accession # | C21orf33, Gene ID: 8209 |
|---|
| Catalog # | NBP2-47532 |
|---|
| Price | |
|---|
| Order / More Info | GATD3A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|