| 产品详情 |
| Edit |   |
| Antigenic Specificity | SUV420h1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SUV420h1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SUV420h1. This antibody reacts with human. The SUV420h1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SUV420h1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DQGEHSGTVGVPVSYTDCAPSPVGCSVVTSDSFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTLR |
| Other Names | C630029K18Rik, CGI85, CGI-85, EC 2.1.1.43, histone-lysine N-methyltransferase SUV420H1, KMT5B, KMT5B Lysine N-methyltransferase 5B, MGC118906, MGC118909, MGC21161, MGC703, Su(var)4-20 homolog 1, Suppressor of variegation 4-20 homolog 1, suppressor of variegation 4-20 homolog 1 (Drosophila), suv4-20h1 |
| Gene, Accession # | SUV420H1, Gene ID: 51111 |
| Catalog # | NBP2-57721 |
| Price | |
| Order / More Info | SUV420h1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|