| Edit |   |
|---|
| Antigenic Specificity | SUSD6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SUSD6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SUSD6. This antibody reacts with human. The SUSD6 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to KIAA0247(KIAA0247) The peptide sequence was selected form the N terminal of KIAA0247. Peptide sequence YLCAEGYMLKGDYKYLTCKNGEWKPAMEISCRLNEDKDTHTSLGVPTLSI. |
|---|
| Other Names | hypothetical protein LOC9766, KIAA0247 |
|---|
| Gene, Accession # | KIAA0247, Gene ID: 9766, Accession: Q92537, SwissProt: Q92537 |
|---|
| Catalog # | NBP1-62569-20ul |
|---|
| Price | |
|---|
| Order / More Info | SUSD6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|