| Edit |   |
| Antigenic Specificity | SUSD4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SUSD4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SUSD4. This antibody reacts with human. The SUSD4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to SUSD4(sushi domain containing 4) The peptide sequence was selected from the middle region of SUSD4. Peptide sequence HGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQV. |
| Other Names | FLJ10052, PRO222, sushi domain containing 4, sushi domain-containing protein 4, YHGM196 |
| Gene, Accession # | SUSD4, Gene ID: 55061, Accession: Q5VX71, SwissProt: Q5VX71 |
| Catalog # | NBP1-59975 |
| Price | |
| Order / More Info | SUSD4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |