| Edit |   |
|---|
| Antigenic Specificity | SUSD4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SUSD4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SUSD4. This antibody reacts with human. The SUSD4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SUSD4(sushi domain containing 4) The peptide sequence was selected from the middle region of SUSD4. Peptide sequence HGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQV. |
|---|
| Other Names | FLJ10052, PRO222, sushi domain containing 4, sushi domain-containing protein 4, YHGM196 |
|---|
| Gene, Accession # | SUSD4, Gene ID: 55061, Accession: Q5VX71, SwissProt: Q5VX71 |
|---|
| Catalog # | NBP1-59975-20ul |
|---|
| Price | |
|---|
| Order / More Info | SUSD4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|