| Edit |   |
|---|
| Antigenic Specificity | SUSD3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SUSD3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SUSD3. This antibody reacts with human. The SUSD3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SUSD3(sushi domain containing 3) The peptide sequence was selected from the N terminal of SUSD3. Peptide sequence LRLPPQATFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEW. |
|---|
| Other Names | MGC26847, sushi domain containing 3, sushi domain-containing protein 3 |
|---|
| Gene, Accession # | SUSD3, Gene ID: 203328, Accession: Q96L08, SwissProt: Q96L08 |
|---|
| Catalog # | NBP1-69242 |
|---|
| Price | |
|---|
| Order / More Info | SUSD3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|