| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GABPA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 50 ul |
|---|
| Concentration | lyophilized |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin. This antibody can be used in Immunohistochemistry (paraffin sections). IHC-P: 4-8 ug/ml *Optimal dilutions should be determined by the end user. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GABPA Antibody from Novus Biologicals is a rabbit polyclonal antibody to GABPA. This antibody reacts with human. The GABPA Antibody has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity: NB100-2050 reacts with GA Binding Protein a chain (GABPA) |
|---|
| Immunogen | Synthetic peptide derived from residues 360-414 of Human GABPA. (Note: the amino acid sequence is proprietary). Peptide sequence KWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIG. |
|---|
| Other Names | E4TF1-60, E4TF1ATranscription factor E4TF1-60, GA binding protein transcription factor, alpha subunit 60kDa, GA-binding protein alpha chain, GA-binding protein transcription factor, alpha subunit (60kD), GABP subunit alpha, human nuclear respiratory factor-2 subunit alpha, 10, NFT2, NRF2, NRF2A, nuclear respiratory factor 2 alpha subunit, Nuclear respiratory factor 2 subunit alpha |
|---|
| Gene, Accession # | GABPA, Gene ID: 2551 |
|---|
| Catalog # | NB100-2050 |
|---|
| Price | |
|---|
| Order / More Info | GABPA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|