| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | L2HGDH |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The L2HGDH Antibody from Novus Biologicals is a rabbit polyclonal antibody to L2HGDH. This antibody reacts with human. The L2HGDH Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human L2HGDH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ISDILRGPAGVRAQALDRDGNLVEDFVFDAGVGDIGNRILHVRNAPSPAATSSIAISGMIADEVQQRFEL |
|---|
| Other Names | 2-hydroxyglutarate dehydrogenase, alpha-ketoglutarate reductase, C14orf160alpha-hydroxyglutarate oxidoreductase, chromosome 14 open reading frame 160, DURANIN, EC 1.1.99.2, FLJ12618, L-2-hydroxyglutarate dehydrogenase, L-2-hydroxyglutarate dehydrogenase, mitochondrial, L-alpha-hydroxyglutarate dehydrogenase |
|---|
| Gene, Accession # | L2HGDH, Gene ID: 79944 |
|---|
| Catalog # | NBP2-57724 |
|---|
| Price | |
|---|
| Order / More Info | L2HGDH Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|