| 产品详情 |
| Edit |   |
| Antigenic Specificity | ARL14EP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ARL14EP Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARL14EP. This antibody reacts with human. The ARL14EP Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human C11orf46 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SAKFGRQLVPGWKLCPKCTQIINGSVDVDTEDRQKRKPESDGRTAKALRSLQFTNPGRQTEFAPETGKREKRRLTKNATAGSDRQVIPAKSKVYDSQGLL |
| Other Names | ADP-ribosylation factor-like 14 effector protein, ARF7EP, C11orf46, chromosome 11 open reading frame 46, dJ299F11.1, FLJ38968, hypothetical protein LOC120534 |
| Gene, Accession # | ARL14EP, Gene ID: 120534 |
| Catalog # | NBP2-48712 |
| Price | |
| Order / More Info | ARL14EP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|