| Edit |   |
|---|
| Antigenic Specificity | ARL2BP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ARL2BP Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARL2BP. This antibody reacts with mouse. The ARL2BP Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide corresponding to mouse Arl2bp - C-terminal region (NP_077231). Peptide Sequence: LQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVT |
|---|
| Other Names | ADP-ribosylation factor-like 2 binding protein, ADP-ribosylation factor-like protein 2-binding protein, ARF-like 2-binding protein, BART1binder of Arl Two, BARTArf-like 2 binding protein BART1, Binder of ARF2 protein 1, binder of Arl2 |
|---|
| Gene, Accession # | ARL2BP, Gene ID: 23568, Accession: Q9D385 |
|---|
| Catalog # | NBP1-98397 |
|---|
| Price | |
|---|
| Order / More Info | ARL2BP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|