| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cytohesin 3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cytohesin 3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cytohesin 3. This antibody reacts with human, mouse. The Cytohesin 3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse Cytohesin 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQIAM |
|---|
| Other Names | ARF nucleotide-binding site opener 3, ARNO3PH, SEC7 and coiled-coil domain-containing protein 3, cytohesin 3, General receptor of phosphoinositides 1, Grp1, GRP1cytohesin-3, pleckstrin homology, Sec7 and coiled-coil domains 3, Protein ARNO3, PSCD3pleckstrin homology, Sec7 and coiled/coil domains 3 |
|---|
| Gene, Accession # | CYTH3, Gene ID: 9265 |
|---|
| Catalog # | NBP1-90097 |
|---|
| Price | |
|---|
| Order / More Info | Cytohesin 3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26239146 |
|---|
| 产品资料 |
|
|