| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cytohesin 2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cytohesin 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cytohesin 2. This antibody reacts with human. The Cytohesin 2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: REELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKF |
|---|
| Other Names | ARF exchange factor, ARF nucleotide-binding site opener, ARNOPH, SEC7 and coiled-coil domain-containing protein 2, CTS18.1, cytohesin 2, pleckstrin homology, Sec7 and coiled-coil domains 2 (cytohesin-2), Protein ARNO, PSCD2LCTS18, PSCD2pleckstrin homology, Sec7 and coiled-coil domains 2, Sec7 and coiled/coil domains 2 (cytohesin-2) |
|---|
| Gene, Accession # | CYTH2, Gene ID: 9266 |
|---|
| Catalog # | NBP2-68764 |
|---|
| Price | |
|---|
| Order / More Info | Cytohesin 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|