| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ACOT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACOT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACOT1. This antibody reacts with human. The ACOT1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ACOT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a Recombinant Protein corresponding to amino acids: YKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWK |
|---|
| Other Names | ACH2, acyl-CoA thioesterase 1Long chain acyl-CoA thioester hydrolase, acyl-coenzyme A thioesterase 1, CTE1, CTE-1, CTE-I, CTE-Ib, EC 3.1.2.2, Inducible cytosolic acyl-coenzyme A thioester hydrolase, LACH2, Long chain acyl-CoA hydrolase |
|---|
| Gene, Accession # | ACOT1, Gene ID: 641371 |
|---|
| Catalog # | NBP2-54709 |
|---|
| Price | |
|---|
| Order / More Info | ACOT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|