| 产品详情 |
| Edit |   |
| Antigenic Specificity | ALK-7/Activin Receptor Type 1C |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ALK-7/Activin Receptor Type 1C Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALK-7/Activin Receptor Type 1C. This antibody reacts with human. The ALK-7/Activin Receptor Type 1C Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ALK-7/Activin Receptor Type 1C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ELSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHL |
| Other Names | activin A receptor, type IC, Activin receptor type IC, activin receptor type-1C, Activin receptor-like kinase 7, ACTR-IC, ACVRLK7, ALK7ALK-7, EC 2.7.11, EC 2.7.11.30 |
| Gene, Accession # | ACVR1C, Gene ID: 130399 |
| Catalog # | NBP1-90253 |
| Price | |
| Order / More Info | ALK-7/Activin Receptor Type 1C Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|