| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PSMB5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PSMB5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PSMB5. This antibody reacts with human. The PSMB5 Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: beta type-5 |
|---|
| Immunogen | Synthetic peptides corresponding to PSMB5(proteasome (prosome, macropain) subunit, beta type, 5) The peptide sequence was selected from the middle region of PSMB5. Peptide sequence IVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQ. |
|---|
| Other Names | LMPXproteasome beta 5 subunit, Macropain epsilon chain, MB1EC 3.4.25.1, Multicatalytic endopeptidase complex epsilon chain, proteasome (prosome, macropain) subunit, beta type, 5, proteasome catalytic subunit 3, Proteasome chain 6, Proteasome epsilon chain, proteasome subunit beta type-5, Proteasome subunit MB1, Proteasome subunit X, proteasome subunit, beta type, 5, PSX large multifunctional protease X, XMGC104214 |
|---|
| Gene, Accession # | PSMB5, Gene ID: 5693, Accession: P28074, SwissProt: P28074 |
|---|
| Catalog # | NBP1-54593 |
|---|
| Price | |
|---|
| Order / More Info | PSMB5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|