| 产品详情 |
| Edit |   |
| Antigenic Specificity | Karyopherin (importin) beta 3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Karyopherin (importin) beta 3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Karyopherin (importin) beta 3. This antibody reacts with human. The Karyopherin (importin) beta 3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Karyopherin (importin) beta 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AAEQQQFYLLLGNLLSPDNVVRKQAEETYEN |
| Other Names | DKFZp686O1576, FLJ43041, IMB3, imp5, importin 5, importin beta-3 subunit, Importin subunit beta-3, importin-5, karyopherin (importin) beta 3, Karyopherin beta-3, KPNB3, MGC2068, RAN binding protein 5, Ran_GTP binding protein 5, Ran-binding protein 5, RANBP5 |
| Gene, Accession # | IPO5, Gene ID: 3843, Accession: O00410, SwissProt: O00410 |
| Catalog # | NBP2-38480 |
| Price | |
| Order / More Info | Karyopherin (importin) beta 3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|