| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CRACC/SLAMF7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CRACC/SLAMF7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CRACC/SLAMF7. This antibody reacts with human. The CRACC/SLAMF7 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CRACC/SLAMF7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSL |
|---|
| Other Names | 19A, CD2 subset 1, CD2-like receptor activating cytotoxic cells, CD319, CD319 antigen, CRACCCD2-like receptor-activating cytotoxic cells, CS119A24 protein, Membrane protein FOAP-12, Novel Ly9, novel LY9 (lymphocyte antigen 9) like protein, Protein 19A, SLAM family member 7 |
|---|
| Gene, Accession # | SLAMF7, Gene ID: 57823 |
|---|
| Catalog # | NBP2-55899 |
|---|
| Price | |
|---|
| Order / More Info | CRACC/SLAMF7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|