| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Filaggrin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. ICC/IF reported in scientific literature (PMID: 29316698). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Filaggrin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Filaggrin. This antibody reacts with human, mouse. The Filaggrin Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Filaggrin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RKRLSERLEEKEDNEEGVYDYENTGRMTQKWIQSGHIATYYTIQDEAYDTTDSLLEENKIYERSRSSDGKSSSQVNRSRHENTSQVPLQESR |
|---|
| Other Names | ATOD2, epidermal filaggrin, filaggrin, Profilaggrin |
|---|
| Gene, Accession # | FLG, Gene ID: 2312 |
|---|
| Catalog # | NBP1-87528 |
|---|
| Price | |
|---|
| Order / More Info | Filaggrin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29316698 |
|---|
| 产品资料 |
|
|