| Edit |   |
|---|
| Antigenic Specificity | RBM7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RBM7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RBM7. This antibody reacts with human. The RBM7 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to RBM7(RNA binding motif protein 7) The peptide sequence was selected from the middle region of RBM7. Peptide sequence SFNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYR. |
|---|
| Other Names | FLJ11153, RNA binding motif protein 7, RNA-binding motif protein 7, RNA-binding protein 7 |
|---|
| Gene, Accession # | RBM7, Gene ID: 10179, Accession: Q9Y580, SwissProt: Q9Y580 |
|---|
| Catalog # | NBP1-57429 |
|---|
| Price | |
|---|
| Order / More Info | RBM7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|