| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RBM6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RBM6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RBM6. This antibody reacts with human. The RBM6 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RBM6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DFRDRDTPHSDFRGRHRSRTDQDFRGREMGSCMEFKDREMPPVDPNILDYIQPSTQDREHSGMNVNRREESTHDHTIERPAFGIQKGEFEH |
|---|
| Other Names | DEF-3, DEF3FLJ39446,3G2, DKFZp686B0877, FLJ36517, FLJ42036, g16, HLC-11, Lung cancer antigen NY-LU-12, lung cancer protooncogene 11, NY-LU-12, Protein G16, RNA binding motif protein 6, RNA-binding motif protein 6, RNA-binding protein 6, RNA-binding protein DEF-3 |
|---|
| Gene, Accession # | RBM6, Gene ID: 10180 |
|---|
| Catalog # | NBP1-89377 |
|---|
| Price | |
|---|
| Order / More Info | RBM6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|