| 产品详情 |
| Edit |   |
| Antigenic Specificity | GIMAP4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 23041938). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GIMAP4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GIMAP4. This antibody reacts with human. The GIMAP4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GIMAP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EDIQDLMDIFGDRYCALNNKATGAEQEAQRAQLLGLIQRVVRENKEGCYTNRMYQRAEEEIQKQTQAMQELHRVELE |
| Other Names | GTPase IMAP family member 4, GTPase, IMAP family member 4, HIMAP4, human immune associated nucleotide 1, IAN-1, IAN1FLJ11110, IMAP4hIAN1, immunity associated protein 4, Immunity-associated nucleotide 1 protein, Immunity-associated protein 4 |
| Gene, Accession # | GIMAP4, Gene ID: 55303 |
| Catalog # | NBP1-83778 |
| Price | |
| Order / More Info | GIMAP4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23041938 |
| 产品资料 |
|
|