| 产品详情 |
| Edit |   |
| Antigenic Specificity | TR2/NR2C1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TR2/NR2C1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TR2/NR2C1. This antibody reacts with human. The TR2/NR2C1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TR2/NR2C1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKV |
| Other Names | nuclear receptor subfamily 2 group C member 1, nuclear receptor subfamily 2, group C isoform, nuclear receptor subfamily 2, group C, member 1, Orphan nuclear receptor TR2, Testicular receptor 2, TR2, TR2 nuclear hormone receptor, TR2-11 |
| Gene, Accession # | NR2C1, Gene ID: 7181 |
| Catalog # | NBP2-56277 |
| Price | |
| Order / More Info | TR2/NR2C1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|