| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TRMU |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRMU Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRMU. This antibody reacts with human. The TRMU Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TRMU antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AVDNLGADAIATGHYARTSLEDEEVFEQKHVKKPEGLFRNRFEVRNAVKLLQAADSFKDQTFFLSQVS |
|---|
| Other Names | EC 2.8.1, EC 2.8.1.-, FLJ10140, mitochondrial 5-methylaminomethyl-2-thiouridylate-methyltransferase, mitochondrial tRNA-specific 2-thiouridylase 1, MTO2 homolog, MTO2MGC99627, MTU1, TRMT, TRMT1, tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase, tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase, TRNT1 |
|---|
| Gene, Accession # | TRMU, Gene ID: 55687, Accession: O75648 |
|---|
| Catalog # | NBP2-58360 |
|---|
| Price | |
|---|
| Order / More Info | TRMU Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|