| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | POP7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICCIF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The POP7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to POP7. This antibody reacts with human. The POP7 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human POP7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK |
|---|
| Other Names | 0610037N12Rik, EC 3.1.26.5, hPOP7, processing of precursor 7, ribonuclease P subunit, processing of precursor 7, ribonuclease P subunit (S. cerevisiae), processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae), ribonuclease P protein subunit p20, Ribonucleases P/MRP protein subunit POP7 homolog, RNaseP protein p20, RPP20S. cerevisiae) homolog |
|---|
| Gene, Accession # | POP7, Gene ID: 10248 |
|---|
| Catalog # | NBP1-92282 |
|---|
| Price | |
|---|
| Order / More Info | POP7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|